OTC antibody (N-Term)

Catalog No. ABIN629690

Product Details anti-OTC Antibody

Target: OTC (Ornithine Carbamoyltransferase (OTC))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OTC antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: OTC antibody was raised against the N terminal of OTC

Purification: Purified

Immunogen: OTC antibody was raised using the N terminal of OTC corresponding to a region with amino acids AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OTC Blocking Peptide, catalog no. 33R-1173, is also available for use as a blocking control in assays to test for specificity of this OTC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OTC

Target: OTC (Ornithine Carbamoyltransferase (OTC))

Alternative Name: OTC (OTC Products)

Synonyms: OCTD antibody, 2810428A13Rik antibody, AA589422 antibody, AW457381 antibody, OCT antibody, Plxn2 antibody, mKIAA0463 antibody, F1B16.13 antibody, F1B16_13 antibody, ORNITHINE CARBAMOYLTRANSFERASE antibody, ornithine carbamoyltransferase antibody, BA4351 antibody, PSPTO4164 antibody, PLXN2 antibody, AI265390 antibody, Sf antibody, spf antibody, si:dkey-19h21.3 antibody, ornithine carbamoyltransferase antibody, plexin A2 antibody, ornithine carbamoyltransferase ArgF antibody, ornithine transcarbamylase antibody, OTC antibody, Plxna2 antibody, Otc antibody, argF antibody, argF-2 antibody, atpD-2 antibody, CNC04300 antibody, PLXNA2 antibody, otc antibody

Background: OTC is a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also.

Molecular Weight: 39 kDa (MW of target protein)