NDUFV1 antibody
-
- Target See all NDUFV1 Antibodies
- NDUFV1 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 1, 51kDa (NDUFV1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NDUFV1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- NDUFV1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG
- Top Product
- Discover our top product NDUFV1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NDUFV1 Blocking Peptide, catalog no. 33R-2999, is also available for use as a blocking control in assays to test for specificity of this NDUFV1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFV1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDUFV1 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 1, 51kDa (NDUFV1))
- Alternative Name
- NDUFV1 (NDUFV1 Products)
- Synonyms
- GB17095 antibody, uqor1 antibody, DDBDRAFT_0188174 antibody, DDBDRAFT_0191420 antibody, DDB_0188174 antibody, DDB_0191420 antibody, wu:fc01f01 antibody, wu:fc12f12 antibody, zgc:86620 antibody, CI-51kD antibody, CI-51K antibody, CI51KD antibody, UQOR1 antibody, NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial antibody, NADH:ubiquinone oxidoreductase core subunit V1 antibody, NADH dehydrogenase ubiquinone flavoprotein 1 antibody, NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa antibody, NADH dehydrogenase (ubiquinone) flavoprotein 1 antibody, NADH:ubiquinone oxidoreductase core subunit V1 L homeolog antibody, LOC408367 antibody, NDUFV1 antibody, ndufv1 antibody, Ndufv1 antibody, LOC100179486 antibody, ndufv1.L antibody
- Background
- The NDUFV1 gene encodes the 51 kDa subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.
- Molecular Weight
- 51 kDa (MW of target protein)
-