ALDH4A1 antibody (C-Term)
-
- Target See all ALDH4A1 Antibodies
- ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALDH4A1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ALDH4 A1 antibody was raised against the C terminal of ALDH4 1
- Purification
- Purified
- Immunogen
- ALDH4 A1 antibody was raised using the C terminal of ALDH4 1 corresponding to a region with amino acids RNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVI
- Top Product
- Discover our top product ALDH4A1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALDH4A1 Blocking Peptide, catalog no. 33R-8071, is also available for use as a blocking control in assays to test for specificity of this ALDH4A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))
- Alternative Name
- ALDH4A1 (ALDH4A1 Products)
- Background
- ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.
- Molecular Weight
- 62 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-