ALDH4A1 antibody (N-Term)
-
- Target See all ALDH4A1 Antibodies
- ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALDH4A1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ALDH4 A1 antibody was raised against the N terminal of ALDH4 1
- Purification
- Purified
- Immunogen
- ALDH4 A1 antibody was raised using the N terminal of ALDH4 1 corresponding to a region with amino acids QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL
- Top Product
- Discover our top product ALDH4A1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALDH4A1 Blocking Peptide, catalog no. 33R-7563, is also available for use as a blocking control in assays to test for specificity of this ALDH4A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))
- Alternative Name
- ALDH4A1 (ALDH4A1 Products)
- Synonyms
- aldh4 antibody, p5cd antibody, p5cdh antibody, ALDH4 antibody, P5CD antibody, P5CDh antibody, A930035F14Rik antibody, Ahd-1 antibody, Ahd1 antibody, Aldh4 antibody, Aldh5a1 antibody, E330022C09 antibody, P5cd antibody, P5cdh antibody, P5cdhl antibody, P5cdhs antibody, Ssdh1 antibody, zgc:63592 antibody, aldehyde dehydrogenase 4 family member A1 antibody, aldehyde dehydrogenase 4 family, member A1 antibody, aldehyde dehydrogenase 4 family member A1 L homeolog antibody, aldh4a1 antibody, ALDH4A1 antibody, Aldh4a1 antibody, aldh4a1.L antibody
- Background
- ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.
- Molecular Weight
- 24 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-