ECH1 antibody (N-Term)

Catalog No. ABIN629677

Product Details anti-ECH1 Antibody

Target: ECH1 (Enoyl Coenzyme A Hydratase 1, Peroxisomal (ECH1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ECH1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ECH1 antibody was raised against the N terminal of ECH1

Purification: Purified

Immunogen: ECH1 antibody was raised using the N terminal of ECH1 corresponding to a region with amino acids PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ECH1 Blocking Peptide, catalog no. 33R-7014, is also available for use as a blocking control in assays to test for specificity of this ECH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ECH1

Target: ECH1 (Enoyl Coenzyme A Hydratase 1, Peroxisomal (ECH1))

Alternative Name: ECH1 (ECH1 Products)

Synonyms: HPXEL antibody, Pxel antibody, AA617331 antibody, enoyl-CoA hydratase 1, peroxisomal antibody, enoyl CoA hydratase 1, peroxisomal antibody, enoyl-CoA hydratase 1 antibody, delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial antibody, enoyl-CoA hydratase 1, peroxisomal L homeolog antibody, enoyl coenzyme A hydratase 1, peroxisomal antibody, ech1 antibody, ECH1 antibody, LOC747511 antibody, ech1.L antibody, Ech1 antibody

Background: ECH1 is a member of the hydratase/isomerase superfamily. ECH1 shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The protein contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process