S100A3 antibody (N-Term)

Catalog No. ABIN629669

Product Details anti-S100A3 Antibody

Target: S100A3 (S100 Calcium Binding Protein A3 (S100A3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This S100A3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: S100 A3 antibody was raised against the N terminal of S100 3

Purification: Purified

Immunogen: S100 A3 antibody was raised using the N terminal of S100 3 corresponding to a region with amino acids MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

S100A3 Blocking Peptide, catalog no. 33R-5733, is also available for use as a blocking control in assays to test for specificity of this S100A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for S100A3

Target: S100A3 (S100 Calcium Binding Protein A3 (S100A3))

Alternative Name: S100A3 (S100A3 Products)

Synonyms: S100E antibody, S100 calcium binding protein A3 antibody, S100A3 antibody, S100a3 antibody

Background: S100A3 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.

Molecular Weight: 11 kDa (MW of target protein)

Pathways: S100 Proteins