S100A3 antibody (N-Term)
-
- Target See all S100A3 Antibodies
- S100A3 (S100 Calcium Binding Protein A3 (S100A3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This S100A3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- S100 A3 antibody was raised against the N terminal of S100 3
- Purification
- Purified
- Immunogen
- S100 A3 antibody was raised using the N terminal of S100 3 corresponding to a region with amino acids MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF
- Top Product
- Discover our top product S100A3 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
S100A3 Blocking Peptide, catalog no. 33R-5733, is also available for use as a blocking control in assays to test for specificity of this S100A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- S100A3 (S100 Calcium Binding Protein A3 (S100A3))
- Alternative Name
- S100A3 (S100A3 Products)
- Background
- S100A3 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.
- Molecular Weight
- 11 kDa (MW of target protein)
- Pathways
- S100 Proteins
-