CKMT2 antibody

Catalog No. ABIN629666

Product Details anti-CKMT2 Antibody

Target: CKMT2 (Creatine Kinase, Mitochondrial 2 (Sarcomeric) (CKMT2))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CKMT2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: CKMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CKMT2 Blocking Peptide, catalog no. 33R-3621, is also available for use as a blocking control in assays to test for specificity of this CKMT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKMT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CKMT2

Target: CKMT2 (Creatine Kinase, Mitochondrial 2 (Sarcomeric) (CKMT2))

Alternative Name: CKMT2 (CKMT2 Products)

Synonyms: 2300008A19Rik antibody, ScCKmit antibody, MIBCK antibody, SMTCK antibody, ckmt2-2 antibody, zgc:73059 antibody, CKMT2 antibody, Mib-CK antibody, S-MtCK antibody, creatine kinase, mitochondrial 2 antibody, creatine kinase, mitochondrial 2 (sarcomeric) antibody, creatine kinase, mitochondrial 2b (sarcomeric) antibody, CKMT2 antibody, ckmt2 antibody, Ckmt2 antibody, ckmt2b antibody

Background: Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes.

Molecular Weight: 46 kDa (MW of target protein)