MTHFD2 antibody

Catalog No. ABIN629664

Product Details anti-MTHFD2 Antibody

Target: MTHFD2 (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2, Methenyltetrahydrofolate Cyclohydrolase (MTHFD2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTHFD2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTHFD2 Blocking Peptide, catalog no. 33R-5273, is also available for use as a blocking control in assays to test for specificity of this MTHFD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTHFD2

Target: MTHFD2 (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2, Methenyltetrahydrofolate Cyclohydrolase (MTHFD2))

Alternative Name: MTHFD2 (MTHFD2 Products)

Synonyms: nmdmc antibody, AW558851 antibody, NMDMC antibody, wu:fb38b11 antibody, wu:fe12e11 antibody, zgc:91891 antibody, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase L homeolog antibody, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase antibody, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2 like S homeolog antibody, methylenetetrahydrofolate dehydrogenase (NAD+ dependent), methenyltetrahydrofolate cyclohydrolase antibody, mthfd2.L antibody, MTHFD2 antibody, mthfd2 antibody, mthfd2l.S antibody, Mthfd2 antibody

Background: MTHFD2 is a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD.

Molecular Weight: 35 kDa (MW of target protein)