AK4 antibody (Middle Region)

Catalog No. ABIN629661

Product Details anti-AK4 Antibody

Target: AK4 (Adenylate Kinase 4 (AK4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AK4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AK3 L1 antibody was raised against the middle region of AK3 1

Purification: Purified

Immunogen: AK3 L1 antibody was raised using the middle region of AK3 1 corresponding to a region with amino acids RWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYK

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AK3L1 Blocking Peptide, catalog no. 33R-8265, is also available for use as a blocking control in assays to test for specificity of this AK3L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AK4

Target: AK4 (Adenylate Kinase 4 (AK4))

Alternative Name: AK3L1 (AK4 Products)

Synonyms: AK 4 antibody, AK3 antibody, AK3L1 antibody, AK3L2 antibody, ak3l1 antibody, wu:fc37g02 antibody, zgc:85790 antibody, AK4 antibody, Ak-3 antibody, Ak-4 antibody, Ak3 antibody, Ak3l1 antibody, D4Ertd274e antibody, Ak3l2 antibody, adenylate kinase 4 antibody, AK4 antibody, ak4 antibody, Ak4 antibody, ADK4 antibody

Background: AK3L1 is a member of the adenylate kinase family of enzymes. The protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process