UPB1 antibody (Middle Region)

Catalog No. ABIN629651

Product Details anti-UPB1 Antibody

Target: UPB1 (Ureidopropionase, beta (UPB1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio), Drosophila melanogaster, Arabidopsis, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UPB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UPB1 antibody was raised against the middle region of UPB1

Purification: Purified

Immunogen: UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UPB1 Blocking Peptide, catalog no. 33R-1619, is also available for use as a blocking control in assays to test for specificity of this UPB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UPB1

Target: UPB1 (Ureidopropionase, beta (UPB1))

Alternative Name: UPB1 (UPB1 Products)

Synonyms: MGC82230 antibody, wu:fb69e03 antibody, zgc:64020 antibody, BUP1 antibody, AI195023 antibody, Bup1 antibody, ureidopropionase, beta S homeolog antibody, beta-ureidopropionase 1 antibody, ureidopropionase, beta antibody, UreidoPropionase Beta antibody, upb1.S antibody, UPB1 antibody, upb1 antibody, upb-1 antibody, Upb1 antibody

Background: UPB1 is a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity.

Molecular Weight: 42 kDa (MW of target protein)