Asialoglycoprotein Receptor 1 antibody (N-Term)

Catalog No. ABIN629649

Product Details anti-Asialoglycoprotein Receptor 1 Antibody

Target: Asialoglycoprotein Receptor 1 (ASGR1)

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Asialoglycoprotein Receptor 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ASGR1 antibody was raised against the N terminal of ASGR1

Purification: Purified

Immunogen: ASGR1 antibody was raised using the N terminal of ASGR1 corresponding to a region with amino acids RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS

Application Details

Application Notes: WB: 0.6 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASGR1 Blocking Peptide, catalog no. 33R-8004, is also available for use as a blocking control in assays to test for specificity of this ASGR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASGR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Asialoglycoprotein Receptor 1

Target: Asialoglycoprotein Receptor 1 (ASGR1)

Alternative Name: ASGR1 (ASGR1 Products)

Synonyms: ASGR1 antibody, ASGPR antibody, ASGPR1 antibody, CLEC4H1 antibody, HL-1 antibody, Asgr antibody, Asgr-1 antibody, ASGR antibody, RATRHL1 antibody, RHL1 antibody, asialoglycoprotein receptor 1 antibody, LOC721786 antibody, ASGR1 antibody, LOC489461 antibody, Asgr1 antibody, LOC101116157 antibody

Background: ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis