PCMTD1 antibody

Catalog No. ABIN629648

Product Details anti-PCMTD1 Antibody

Target: PCMTD1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Domain Containing 1 (PCMTD1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCMTD1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: PCMTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIY

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCMTD1 Blocking Peptide, catalog no. 33R-9092, is also available for use as a blocking control in assays to test for specificity of this PCMTD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCMTD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCMTD1

Target: PCMTD1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Domain Containing 1 (PCMTD1))

Alternative Name: PCMTD1 (PCMTD1 Products)

Synonyms: fd15e12 antibody, wu:fd15e12 antibody, wu:fi15f10 antibody, zgc:123165 antibody, 8430411F12Rik antibody, A030012M09Rik antibody, RGD1307986 antibody, protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1 antibody, Protein-L-isoaspartate O-methyltransferase domain-containing protein 1 antibody, pcmtd1 antibody, pcmd1 antibody, PCMTD1 antibody, Pcmtd1 antibody

Background: The function of PCMTD1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 41 kDa (MW of target protein)