FAM107A antibody (Middle Region)

Catalog No. ABIN629643

Product Details anti-FAM107A Antibody

Target: FAM107A (Family with Sequence Similarity 107, Member A (FAM107A))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM107A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM107 A antibody was raised against the middle region of FAM107

Purification: Purified

Immunogen: FAM107 A antibody was raised using the middle region of FAM107 corresponding to a region with amino acids RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE

Application Details

Application Notes: WB: 0.0625 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM107A Blocking Peptide, catalog no. 33R-8045, is also available for use as a blocking control in assays to test for specificity of this FAM107A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM100 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM107A

Target: FAM107A (Family with Sequence Similarity 107, Member A (FAM107A))

Alternative Name: FAM107A (FAM107A Products)

Synonyms: drr1 antibody, tu3a antibody, xdrr1 antibody, DRR1 antibody, TU3A antibody, Drr1 antibody, RGD1306327 antibody, Tu3a antibody, family with sequence similarity 107 member A S homeolog antibody, family with sequence similarity 107 member A antibody, family with sequence similarity 107, member A antibody, fam107a.S antibody, FAM107A antibody, Fam107a antibody

Background: When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.

Molecular Weight: 17 kDa (MW of target protein)