RSRC2 antibody (C-Term)
-
- Target See all RSRC2 Antibodies
- RSRC2 (arginine/serine-Rich Coiled-Coil 2 (RSRC2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RSRC2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- RSRC2 antibody was raised against the C terminal of RSRC2
- Purification
- Purified
- Immunogen
- RSRC2 antibody was raised using the C terminal of RSRC2 corresponding to a region with amino acids DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARS
-
anti-arginine/serine-Rich Coiled-Coil 2 (RSRC2) (AA 363-412) antibody
RSRC2 Reactivity: Human, Mouse, Rat, Dog, Rabbit, Cow, Guinea Pig, Horse, Bat, Chicken, Monkey, Pig WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-arginine/serine-Rich Coiled-Coil 2 (RSRC2) (C-Term) antibodyRSRC2 Reactivity: Human, Mouse, Rat, Dog, Rabbit, Cow, Guinea Pig, Horse WB, IHC Host: Rabbit Polyclonal unconjugated
anti-arginine/serine-Rich Coiled-Coil 2 (RSRC2) (AA 8-37), (N-Term) antibodyRSRC2 Reactivity: Human WB Host: Rabbit Polyclonal RB37755 unconjugated
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RSRC2 Blocking Peptide, catalog no. 33R-2134, is also available for use as a blocking control in assays to test for specificity of this RSRC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSRC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RSRC2 (arginine/serine-Rich Coiled-Coil 2 (RSRC2))
- Alternative Name
- RSRC2 (RSRC2 Products)
- Synonyms
- 1500011J06Rik antibody, flj11021 antibody, ik:tdsubc_1d5 antibody, si:ch211-110p13.2 antibody, wu:fc56g08 antibody, xx:tdsubc_1d5 antibody, zgc:85695 antibody, arginine and serine rich coiled-coil 2 antibody, arginine/serine-rich coiled-coil 2 antibody, arginine/serine-rich coiled-coil 2 L homeolog antibody, RSRC2 antibody, Rsrc2 antibody, rsrc2.L antibody, rsrc2 antibody
- Background
- In vitro study revealed that RSRC2 might play a role in cell proliferation. RSRC2 may be a novel tumor suppressor of esophageal cancer cell growth.
- Molecular Weight
- 50 kDa (MW of target protein)
-
