WDR4 antibody (C-Term)
-
- Target See all WDR4 Antibodies
- WDR4 (WD Repeat Domain 4 (WDR4))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WDR4 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- WDR4 antibody was raised against the C terminal of WDR4
- Purification
- Purified
- Immunogen
- WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
- Top Product
- Discover our top product WDR4 Primary Antibody
-
anti-WD Repeat Domain 4 (WDR4) (AA 1-266) antibody
WDR4 Reactivity: Human WB, ELISA, IHC (p) Host: Mouse Monoclonal 1F9 unconjugated
anti-WD Repeat Domain 4 (WDR4) (AA 1-412) antibodyWDR4 Reactivity: Human WB, IP, IF Host: Rabbit Polyclonal unconjugated
anti-WD Repeat Domain 4 (WDR4) antibodyWDR4 Reactivity: Human WB, IHC Host: Rabbit Monoclonal unconjugated
anti-WD Repeat Domain 4 (WDR4) antibodyWDR4 Reactivity: Human, Mouse WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-WD Repeat Domain 4 (WDR4) (C-Term) antibodyWDR4 Reactivity: Human, Mouse, Rat WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-WD Repeat Domain 4 (WDR4) (AA 146-173) antibodyWDR4 Reactivity: Human WB Host: Rabbit Polyclonal RB36209 unconjugated
anti-WD Repeat Domain 4 (WDR4) (AA 36-85) antibodyWDR4 Reactivity: Human, Horse, Dog, Guinea Pig, Bat, Monkey WB Host: Rabbit Polyclonal unconjugated
anti-WD Repeat Domain 4 (WDR4) (AA 20-250) antibodyWDR4 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-WD Repeat Domain 4 (WDR4) (N-Term) antibodyWDR4 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-WD Repeat Domain 4 (WDR4) (C-Term) antibodyWDR4 Reactivity: Human, Mouse, Rat, Horse, Rabbit, Cow, Saccharomyces cerevisiae, Pig WB, IHC Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WDR4 Blocking Peptide, catalog no. 33R-1185, is also available for use as a blocking control in assays to test for specificity of this WDR4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WDR4 (WD Repeat Domain 4 (WDR4))
- Alternative Name
- WDR4 (WDR4 Products)
- Synonyms
- TRM82 antibody, TRMT82 antibody, AI415180 antibody, AI448349 antibody, D530049K22Rik antibody, WD repeat domain 4 antibody, WD repeat domain 4 S homeolog antibody, WDR4 antibody, Wdr4 antibody, wdr4.S antibody
- Background
- WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
- Molecular Weight
- 45 kDa (MW of target protein)
-
