CACYBP antibody (Middle Region)

Catalog No. ABIN629637

Product Details anti-CACYBP Antibody

Target: CACYBP (Calcyclin Binding Protein (CACYBP))

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CACYBP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CACYBP antibody was raised against the middle region of CACYBP

Purification: Purified

Immunogen: CACYBP antibody was raised using the middle region of CACYBP corresponding to a region with amino acids FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CACYBP Blocking Peptide, catalog no. 33R-3089, is also available for use as a blocking control in assays to test for specificity of this CACYBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACYBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CACYBP

Target: CACYBP (Calcyclin Binding Protein (CACYBP))

Alternative Name: CACYBP (CACYBP Products)

Synonyms: zgc:76993 antibody, CACYBP antibody, sip antibody, gig5 antibody, pnas-107 antibody, s100a6bp antibody, T1P2.12 antibody, T1P2_12 antibody, GIG5 antibody, RP1-102G20.6 antibody, S100A6BP antibody, SIP antibody, calcyclin binding protein antibody, calcyclin binding protein, putative antibody, Calcyclin binding protein, putative antibody, SGS domain-containing protein antibody, calcyclin binding protein L homeolog antibody, cacybp antibody, CACYBP antibody, PB000926.02.0 antibody, PCHAS_145490 antibody, PVX_100855 antibody, PKH_145680 antibody, AT1G30070 antibody, cacybp.L antibody, Cacybp antibody

Background: CACYBP is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus