STRAP antibody (C-Term)
-
- Target See all STRAP Antibodies
- STRAP (Serine/threonine Kinase Receptor Associated Protein (STRAP))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This STRAP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- STRAP antibody was raised against the C terminal of STRAP
- Purification
- Purified
- Immunogen
- STRAP antibody was raised using the C terminal of STRAP corresponding to a region with amino acids ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEEL
- Top Product
- Discover our top product STRAP Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
STRAP Blocking Peptide, catalog no. 33R-1507, is also available for use as a blocking control in assays to test for specificity of this STRAP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRAP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STRAP (Serine/threonine Kinase Receptor Associated Protein (STRAP))
- Alternative Name
- STRAP (STRAP Products)
- Background
- The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex.
- Molecular Weight
- 38 kDa (MW of target protein)
-