ZNF19 antibody (C-Term)
-
- Target See all ZNF19 Antibodies
- ZNF19 (Zinc Finger Protein 19 (ZNF19))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZNF19 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZNF19 antibody was raised against the C terminal of ZNF19
- Purification
- Purified
- Immunogen
- ZNF19 antibody was raised using the C terminal of ZNF19 corresponding to a region with amino acids HQHQRIHTGEKPYECSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLP
- Top Product
- Discover our top product ZNF19 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZNF19 Blocking Peptide, catalog no. 33R-3824, is also available for use as a blocking control in assays to test for specificity of this ZNF19 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF19 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZNF19 (Zinc Finger Protein 19 (ZNF19))
- Alternative Name
- ZNF19 (ZNF19 Products)
- Background
- ZNF19 contains a zinc finger, a nucleic acid-binding domain present in many transcription factors.
- Molecular Weight
- 52 kDa (MW of target protein)
-