PRP19 antibody

Catalog No. ABIN629621

Product Details anti-PRP19 Antibody

Target: PRP19 (PRPF19) (Pre-mRNA Processing Factor 19 (PRPF19))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRP19 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: PRPF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRPF19 Blocking Peptide, catalog no. 33R-9720, is also available for use as a blocking control in assays to test for specificity of this PRPF19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRP19

Target: PRP19 (PRPF19) (Pre-mRNA Processing Factor 19 (PRPF19))

Alternative Name: PRPF19 (PRPF19 Products)

Synonyms: NMP200 antibody, fb18f09 antibody, zgc:56158 antibody, wu:fb18f09 antibody, nmp200 antibody, PRP19 antibody, PSO4 antibody, SNEV antibody, UBOX4 antibody, hPSO4 antibody, Prp19 antibody, nmp-200 antibody, AA617263 antibody, AL024362 antibody, D19Wsu55e antibody, Snev antibody, pre-mRNA processing factor 19 antibody, pre-mRNA processing factor 19 L homeolog antibody, prpf19 antibody, prpf19.L antibody, PRPF19 antibody, Prpf19 antibody

Background: PRPF19 plays a role in DNA double-strand break (DSB) repair and pre-mRNA splicing reaction. It binds double-stranded DNA in a sequence-nonspecific manner. PRPF19 acts as a structural component of the nuclear framework. It may also serve as a support for spliceosome binding and activity. It is essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. It also may have E3 ubiquitin ligase activity.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization