SETD7 antibody
-
- Target See all SETD7 Antibodies
- SETD7 (SET Domain Containing (Lysine Methyltransferase) 7 (SETD7))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SETD7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- SETD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF
- Top Product
- Discover our top product SETD7 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SETD7 Blocking Peptide, catalog no. 33R-7322, is also available for use as a blocking control in assays to test for specificity of this SETD7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SETD7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SETD7 (SET Domain Containing (Lysine Methyltransferase) 7 (SETD7))
- Alternative Name
- SETD7 (SETD7 Products)
- Synonyms
- KMT7 antibody, SET7 antibody, SET7/9 antibody, SET9 antibody, set7 antibody, zgc:101860 antibody, zgc:92330 antibody, 1600028F23Rik antibody, H3K4MT antibody, Set7 antibody, Set7/9 antibody, mKIAA1717 antibody, SET domain containing lysine methyltransferase 7 antibody, SET domain containing (lysine methyltransferase) 7 antibody, SETD7 antibody, setd7 antibody, Setd7 antibody
- Background
- SETD7 is a histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. It plays a central role in the transcriptional activation of genes such as collagenase or insulin. It is recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. It has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins.
- Molecular Weight
- 41 kDa (MW of target protein)
-