ANKRD11 antibody (N-Term)

Catalog No. ABIN629618

Product Details anti-ANKRD11 Antibody

Target: ANKRD11 (Ankyrin Repeat Domain 11 (ANKRD11))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKRD11 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ANKRD11 antibody was raised against the N terminal of ANKRD11

Purification: Purified

Immunogen: ANKRD11 antibody was raised using the N terminal of ANKRD11 corresponding to a region with amino acids KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKRD11 Blocking Peptide, catalog no. 33R-4627, is also available for use as a blocking control in assays to test for specificity of this ANKRD11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKRD11

Target: ANKRD11 (Ankyrin Repeat Domain 11 (ANKRD11))

Alternative Name: ANKRD11 (ANKRD11 Products)

Synonyms: ANCO-1 antibody, ANCO1 antibody, LZ16 antibody, T13 antibody, 2410104C19Rik antibody, 3010027A04Rik antibody, 6330578C09Rik antibody, 9530048I21Rik antibody, AA930108 antibody, Gm176 antibody, Yod antibody, ANKRD11 antibody, wu:fc59e05 antibody, wu:fi04c06 antibody, ankyrin repeat domain 11 antibody, ankyrin repeat domain 11 L homeolog antibody, ANKRD11 antibody, Ankrd11 antibody, ankrd11.L antibody, ankrd11 antibody

Background: ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.

Molecular Weight: 298 kDa (MW of target protein)