ANKRD11 antibody (N-Term)
-
- Target See all ANKRD11 Antibodies
- ANKRD11 (Ankyrin Repeat Domain 11 (ANKRD11))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ANKRD11 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ANKRD11 antibody was raised against the N terminal of ANKRD11
- Purification
- Purified
- Immunogen
- ANKRD11 antibody was raised using the N terminal of ANKRD11 corresponding to a region with amino acids KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR
- Top Product
- Discover our top product ANKRD11 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ANKRD11 Blocking Peptide, catalog no. 33R-4627, is also available for use as a blocking control in assays to test for specificity of this ANKRD11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANKRD11 (Ankyrin Repeat Domain 11 (ANKRD11))
- Alternative Name
- ANKRD11 (ANKRD11 Products)
- Background
- ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.
- Molecular Weight
- 298 kDa (MW of target protein)
-