NMNAT1 antibody (N-Term)

Catalog No. ABIN629615

Product Details anti-NMNAT1 Antibody

Target: NMNAT1 (Nicotinamide Nucleotide Adenylyltransferase 1 (NMNAT1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NMNAT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NMNAT1 antibody was raised against the N terminal of NMNAT1

Purification: Purified

Immunogen: NMNAT1 antibody was raised using the N terminal of NMNAT1 corresponding to a region with amino acids PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NMNAT1 Blocking Peptide, catalog no. 33R-7409, is also available for use as a blocking control in assays to test for specificity of this NMNAT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMNAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NMNAT1

Target: NMNAT1 (Nicotinamide Nucleotide Adenylyltransferase 1 (NMNAT1))

Alternative Name: NMNAT1 (NMNAT1 Products)

Background: The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD.

Molecular Weight: 32 kDa (MW of target protein)