SWAP70 antibody (N-Term)
-
- Target See all SWAP70 Antibodies
- SWAP70 (SWAP Switching B-Cell Complex 70kDa Subunit (SWAP70))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SWAP70 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SWAP70 antibody was raised against the N terminal of SWAP70
- Purification
- Purified
- Immunogen
- SWAP70 antibody was raised using the N terminal of SWAP70 corresponding to a region with amino acids ALEEHFRDDDEGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVK
- Top Product
- Discover our top product SWAP70 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SWAP70 Blocking Peptide, catalog no. 33R-1326, is also available for use as a blocking control in assays to test for specificity of this SWAP70 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SWAP70 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SWAP70 (SWAP Switching B-Cell Complex 70kDa Subunit (SWAP70))
- Alternative Name
- SWAP70 (SWAP70 Products)
- Background
- Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. SWAP70 also mediates signaling of membrane ruffling. It regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion.
- Molecular Weight
- 69 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response
-