PEX3 antibody (N-Term)

Catalog No. ABIN629613

Product Details anti-PEX3 Antibody

Target: PEX3 (Peroxisomal Biogenesis Factor 3 (PEX3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEX3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PEX3 antibody was raised against the N terminal of PEX3

Purification: Purified

Immunogen: PEX3 antibody was raised using the N terminal of PEX3 corresponding to a region with amino acids KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PEX3 Blocking Peptide, catalog no. 33R-4740, is also available for use as a blocking control in assays to test for specificity of this PEX3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PEX3

Target: PEX3 (Peroxisomal Biogenesis Factor 3 (PEX3))

Alternative Name: PEX3 (PEX3 Products)

Synonyms: DDBDRAFT_0204086 antibody, DDBDRAFT_0238047 antibody, DDB_0204086 antibody, DDB_0238047 antibody, zgc:56313 antibody, PBD10A antibody, TRG18 antibody, Peroxin-3 antibody, 1700014F15Rik antibody, 2810027F19Rik antibody, 2900010N04Rik antibody, peroxisomal biogenesis factor 3 antibody, peroxin 3 antibody, peroxisomal biogenesis factor 3 L homeolog antibody, LOC692959 antibody, CpipJ_CPIJ013204 antibody, pex3 antibody, PEX3 antibody, pex3.L antibody, Pex3 antibody

Background: PEX3 is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, it is necessary for the import of peroxisomal membrane proteins in the peroxisomes.

Molecular Weight: 42 kDa (MW of target protein)