CENPA antibody (N-Term)

Catalog No. ABIN629608

Product Details anti-CENPA Antibody

Target: CENPA (Centromere Protein A (CENPA))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CENPA antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CENPA antibody was raised against the N terminal of CENPA

Purification: Purified

Immunogen: CENPA antibody was raised using the N terminal of CENPA corresponding to a region with amino acids MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CENPA Blocking Peptide, catalog no. 33R-6060, is also available for use as a blocking control in assays to test for specificity of this CENPA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CENPA

Target: CENPA (Centromere Protein A (CENPA))

Alternative Name: CENPA (CENPA Products)

Synonyms: CENP-A antibody, CenH3 antibody, Cenp-A antibody, cenpx antibody, cenp-a antibody, sim2 antibody, Cenp-a antibody, RGD1563607 antibody, CENPA antibody, centromere protein A antibody, centromere protein-A antibody, centromeric histone-3 like protein antibody, centromere-specific histone H3 CENP-A antibody, cenp-A antibody, centromere protein A L homeolog antibody, histone H3-like centromeric protein A antibody, CENPA antibody, Cenpa antibody, CENP-A antibody, cenpa antibody, cenp-A antibody, cnp1 antibody, HAN_3g422 antibody, Cenp-a antibody, cenpa.L antibody, CMU_016480 antibody

Background: Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA is a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Chromatin Binding, Maintenance of Protein Location