BMP2K antibody (C-Term)

Catalog No. ABIN629606

Product Details anti-BMP2K Antibody

Target: BMP2K (BMP2 Inducible Kinase (BMP2K))

Binding Specificity: C-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BMP2K antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: BMP2 K antibody was raised against the C terminal of BMP2

Purification: Purified

Immunogen: BMP2 K antibody was raised using the C terminal of BMP2 corresponding to a region with amino acids AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BMP2K Blocking Peptide, catalog no. 33R-1448, is also available for use as a blocking control in assays to test for specificity of this BMP2K antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BMP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BMP2K

Target: BMP2K (BMP2 Inducible Kinase (BMP2K))

Alternative Name: BMP2K (BMP2K Products)

Synonyms: zgc:101641 antibody, BIKE antibody, 4933417M22Rik antibody, AA673486 antibody, AV128808 antibody, BMP2 inducible kinase antibody, BMP-2 inducible kinase antibody, BMP2K antibody, bmp2k antibody, Bmp2k antibody

Background: BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning.

Molecular Weight: 74 kDa (MW of target protein)