eEF1A1 antibody (C-Term)
-
- Target See all eEF1A1 (EEF1A1) Antibodies
- eEF1A1 (EEF1A1) (Eukaryotic Translation Elongation Factor 1 alpha 1 (EEF1A1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This eEF1A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EEF1 A1 antibody was raised against the C terminal of EEF1 1
- Purification
- Purified
- Immunogen
- EEF1 A1 antibody was raised using the C terminal of EEF1 1 corresponding to a region with amino acids IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK
- Top Product
- Discover our top product EEF1A1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EEF1A1 Blocking Peptide, catalog no. 33R-4196, is also available for use as a blocking control in assays to test for specificity of this EEF1A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- eEF1A1 (EEF1A1) (Eukaryotic Translation Elongation Factor 1 alpha 1 (EEF1A1))
- Alternative Name
- EEF1A1 (EEF1A1 Products)
- Synonyms
- CCS-3 antibody, CCS3 antibody, EE1A1 antibody, EEF-1 antibody, EEF1A antibody, EF-Tu antibody, EF1A antibody, GRAF-1EF antibody, HNGC:16303 antibody, LENG7 antibody, PTI1 antibody, eEF1A-1 antibody, Eef1a2 antibody, Eef1a2l1 antibody, SI antibody, EEF1A2 antibody, EF1A1 antibody, eef1a1 antibody, wu:fj34g08 antibody, zgc:110335 antibody, EEF1A1 antibody, RABEFLA2 antibody, EFL1-alpha antibody, chunp6927 antibody, eef1a antibody, ef1a antibody, ik:tdsubc_2a3 antibody, ik:tdsubc_2b3 antibody, tdsubc_2a3 antibody, wu:fa91c07 antibody, wu:fa94b03 antibody, wu:fi13b09 antibody, xx:tdsubc_2a3 antibody, xx:tdsubc_2b3 antibody, EF-1A antibody, EF-1-ALPHA-S antibody, eef1a-s antibody, eef1as antibody, fj64c02 antibody, wu:fj64c02 antibody, zgc:73138 antibody, eukaryotic translation elongation factor 1 alpha 1 antibody, eukaryotic translation elongation factor 1 alpha 1b antibody, eukaryotic translation elongation factor 1 alpha 1, like 1 antibody, eukaryotic translation elongation factor 1 alpha 1 L homeolog antibody, elongation factor 1-alpha antibody, eukaryotic translation elongation factor 1 alpha 1a antibody, EEF1A1 antibody, Eef1a1 antibody, eef1a1b antibody, eef1a1l1 antibody, eef1a1.L antibody, tufA antibody, eef1a1a antibody
- Background
- EEF1A1 is an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome.
- Molecular Weight
- 50 kDa (MW of target protein)
-