CBS antibody (N-Term)

Catalog No. ABIN629598

Product Details anti-CBS Antibody

Target: CBS (Cystathionine-beta-Synthase (CBS))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CBS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CBS antibody was raised against the N terminal of CBS

Purification: Purified

Immunogen: CBS antibody was raised using the N terminal of CBS corresponding to a region with amino acids RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CBS Blocking Peptide, catalog no. 33R-7836, is also available for use as a blocking control in assays to test for specificity of this CBS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-CBS antibody (ABIN629598)

Veerareddy, Dao, Yun, Stokes, Disbrow, Kevil, Cvek, Trutschl, Kilgore, Ramanathan, Zivadinov, Alexander: "Dysregulated Sulfide Metabolism in Multiple Sclerosis: Serum and Vascular Endothelial Inflammatory Responses." in: Pathophysiology : the official journal of the International Society for Pathophysiology, Vol. 29, Issue 3, pp. 570-582, (2022) (PubMed).

Target Details for CBS

Target: CBS (Cystathionine-beta-Synthase (CBS))

Alternative Name: CBS (CBS Products)

Background: CBS is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.

Molecular Weight: 60 kDa (MW of target protein)