METTL7A antibody (N-Term)

Catalog No. ABIN629594

Product Details anti-METTL7A Antibody

Target: METTL7A (Methyltransferase Like 7A (METTL7A))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This METTL7A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: METTL7 A antibody was raised against the N terminal of METTL7

Purification: Purified

Immunogen: METTL7 A antibody was raised using the N terminal of METTL7 corresponding to a region with amino acids MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

METTL7A Blocking Peptide, catalog no. 33R-5748, is also available for use as a blocking control in assays to test for specificity of this METTL7A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for METTL7A

Target: METTL7A (Methyltransferase Like 7A (METTL7A))

Alternative Name: METTL7A (METTL7A Products)

Synonyms: AAM-B antibody, 2210414H16Rik antibody, 3300001H21Rik antibody, Aam-B antibody, Mettl7a antibody, UbiE1 antibody, RGD1308407 antibody, MGC82719 antibody, zgc:153889 antibody, MGC145311 antibody, DKFZp459L026 antibody, methyltransferase like 7A antibody, methyltransferase like 7A1 antibody, methyltransferase like 7A L homeolog antibody, METTL7A antibody, Mettl7a1 antibody, Mettl7a antibody, mettl7a.L antibody, mettl7a antibody

Background: METTL7A is thought to be a methyltransferase enzyme.

Molecular Weight: 20 kDa (MW of target protein)