ECHDC3 antibody (N-Term)
-
- Target See all ECHDC3 Antibodies
- ECHDC3 (Enoyl CoA Hydratase Domain Containing 3 (ECHDC3))
-
Binding Specificity
- N-Term
-
Reactivity
- Rat, Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ECHDC3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ECHDC3 antibody was raised against the N terminal of ECHDC3
- Purification
- Purified
- Immunogen
- ECHDC3 antibody was raised using the N terminal of ECHDC3 corresponding to a region with amino acids SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY
- Top Product
- Discover our top product ECHDC3 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ECHDC3 Blocking Peptide, catalog no. 33R-8576, is also available for use as a blocking control in assays to test for specificity of this ECHDC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ECHDC3 (Enoyl CoA Hydratase Domain Containing 3 (ECHDC3))
- Alternative Name
- ECHDC3 (ECHDC3 Products)
- Synonyms
- 2310005D12Rik antibody, AI662097 antibody, echdc3 antibody, enoyl-CoA hydratase domain containing 3 antibody, enoyl CoA hydratase domain containing 3 antibody, enoyl-CoA hydratase domain containing 3 L homeolog antibody, enoyl Coenzyme A hydratase domain containing 3 antibody, ECHDC3 antibody, Echdc3 antibody, echdc3.L antibody, echdc3 antibody
- Background
- ECHDC3 possesses catalytic activity.
- Molecular Weight
- 40 kDa (MW of target protein)
-