RUNX2 antibody (Middle Region)
-
- Target See all RUNX2 Antibodies
- RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RUNX2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RUNX2 antibody was raised against the middle region of RUNX2
- Purification
- Purified
- Immunogen
- RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM
- Top Product
- Discover our top product RUNX2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RUNX2 Blocking Peptide, catalog no. 33R-2188, is also available for use as a blocking control in assays to test for specificity of this RUNX2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUNX2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))
- Alternative Name
- RUNX2 (RUNX2 Products)
- Synonyms
- AML3 antibody, CBF-alpha-1 antibody, CBFA1 antibody, CCD antibody, CCD1 antibody, CLCD antibody, OSF-2 antibody, OSF2 antibody, PEA2aA antibody, PEBP2aA antibody, Cbf antibody, Cbfa-1 antibody, Cbfa1 antibody, LS3 antibody, Osf2 antibody, Pebp2a1 antibody, Pebpa2a antibody, runx2 antibody, RUNX2 antibody, ccd antibody, aml3 antibody, ccd1 antibody, osf2 antibody, cbfa1 antibody, pea2aa antibody, pebp2a1 antibody, pebp2a2 antibody, pebp2aa antibody, pebp2aa1 antibody, runt related transcription factor 2 antibody, runt-related transcription factor 2a antibody, runt-related transcription factor 2 antibody, runt related transcription factor 2 L homeolog antibody, RUNX2 antibody, runx2a antibody, Runx2 antibody, runx2 antibody, LOC703331 antibody, LOC100549663 antibody, runx2.L antibody
- Background
- RUNX2 is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis, acting as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants, encoding different protein isoforms, result from alternate promoter use as well as alternate splicing.
- Molecular Weight
- 57 kDa (MW of target protein)
-