RORA antibody (Middle Region)
-
- Target See all RORA Antibodies
- RORA (RAR-Related Orphan Receptor A (RORA))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RORA antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- RORA antibody was raised against the middle region of RORA
- Purification
- Purified
- Immunogen
- RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
- Top Product
- Discover our top product RORA Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RORA Blocking Peptide, catalog no. 33R-3316, is also available for use as a blocking control in assays to test for specificity of this RORA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RORA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RORA (RAR-Related Orphan Receptor A (RORA))
- Alternative Name
- RORA (RORA Products)
- Synonyms
- ror1 antibody, ror2 antibody, ror3 antibody, rzra antibody, nr1f1 antibody, MGC146531 antibody, NR1F1 antibody, ROR1 antibody, ROR2 antibody, ROR3 antibody, RZR-ALPHA antibody, RZRA antibody, RORalpha-B antibody, gb:dq017624 antibody, rora2 antibody, 9530021D13Rik antibody, Nr1f1 antibody, nmf267 antibody, sg antibody, staggerer antibody, tmgc26 antibody, RORalpha1 antibody, RAR related orphan receptor A antibody, RAR-related orphan receptor A antibody, RAR-related orphan receptor A, paralog a antibody, RAR-related orphan receptor alpha antibody, RORA antibody, rora antibody, Rora antibody, roraa antibody
- Background
- The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.
- Molecular Weight
- 63 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha
-