DEFB4A antibody (AA 4-41)
-
- Target See all DEFB4A (DEFB4) Antibodies
- DEFB4A (DEFB4) (Defensin, beta 4A (DEFB4))
-
Binding Specificity
- AA 4-41
-
Reactivity
- Human
-
Host
-
Sheep
-
Clonality
- Polyclonal
-
Conjugate
- This DEFB4A antibody is un-conjugated
-
Application
- ELISA, Radioimmunoassay (RIA)
- Specificity
- Recognizes human beta-Defensin 2 (epitope: aa 4-41).
- Predicted Reactivity
- Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla (100%) Gibbon, Monkey (97%) Orangutan (81%).
- Purification
- Protein G purified
- Immunogen
- Synthetic human -Defensin 2 (aa 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla (100%), Gibbon, Monkey (97%), Orangutan (81%).
- Isotype
- IgG
- Top Product
- Discover our top product DEFB4 Primary Antibody
-
-
- Application Notes
-
Approved: ELISA (1:5000), RIA
Usage: Suitable for use in ELISA and RIA. ELISA: 1:5000. - Comment
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Sterile buffer or distilled water
- Concentration
- Lot specific
- Buffer
- Lyophilized from 50 mM Tris, pH 7.4
- Storage
- -20 °C
- Storage Comment
- Lyophilized powder may be stored at -20°C. Aliquot and store at -20°C. Reconstituted product is stable for 1 year at -20°C.
-
- Target
- DEFB4A (DEFB4) (Defensin, beta 4A (DEFB4))
- Alternative Name
- DEFB4A / DEFB2 (DEFB4 Products)
- Synonyms
- BD-2 antibody, DEFB-2 antibody, DEFB102 antibody, DEFB2 antibody, DEFB4 antibody, HBD-2 antibody, SAP1 antibody, BD2 antibody, DEFB4P antibody, THP2 antibody, defensin beta 4A antibody, defensin beta 2 antibody, defensin beta 1 antibody, avian beta-defensin 4 antibody, defensin, beta 4A antibody, beta-defensin 2 antibody, defensin beta 4 antibody, beta defensin 2 antibody, DEFB4A antibody, Defb2 antibody, DEFB1 antibody, AvBD4 antibody, THP2 antibody, defb4 antibody, SBD2 antibody
- Background
-
Name/Gene ID: DEFB4A
Synonyms: DEFB4A, Beta-defensin 2, Beta-defensin 4A, DEFB-2, DEFB102, Defensin, beta 2, Defensin, beta 4, Defensin, beta 4A, DEFB4, DEFB2, HBD-2, Skin-antimicrobial peptide 1, BD-2, SAP1 - Gene ID
- 1673
-