CHRNA3 antibody

Catalog No. ABIN5708503

Product Details anti-CHRNA3 Antibody

Target: CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHRNA3 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS)

Purification: Antigen affinity purified

Immunogen: Amino acids DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD from the human protein were used as the immunogen for the CHRNA3 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the CHRNA3 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the CHRNA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for CHRNA3

Target: CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))

Alternative Name: CHRNA3 (CHRNA3 Products)

Background: After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 (CHRNA3) responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [UniProt]

UniProt: P32297

Pathways: Synaptic Membrane