CHRNA3 antibody
-
- Target See all CHRNA3 Antibodies
- CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHRNA3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Flow Cytometry (FACS)
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD from the human protein were used as the immunogen for the CHRNA3 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product CHRNA3 Primary Antibody
-
-
- Application Notes
- Optimal dilution of the CHRNA3 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the CHRNA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))
- Alternative Name
- CHRNA3 (CHRNA3 Products)
- Background
- After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 (CHRNA3) responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [UniProt]
- UniProt
- P32297
- Pathways
- Synaptic Membrane
-