GFI1 antibody
-
- Target See all GFI1 Antibodies
- GFI1 (Growth Factor Independent 1 (GFI1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GFI1 antibody is un-conjugated
-
Application
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH were used as the immunogen for the GFI1 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product GFI1 Primary Antibody
-
-
- Application Notes
- Optimal dilution of the GFI1 antibody should be determined by the researcher.\. IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the GFI1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- GFI1 (Growth Factor Independent 1 (GFI1))
- Alternative Name
- GFI1 (GFI1 Products)
- Synonyms
- AW495828 antibody, Gfi-1 antibody, Pal-1 antibody, Pal1 antibody, GFI1 antibody, GFI-1 antibody, GFI1A antibody, SCN2 antibody, ZNF163 antibody, growth factor independent 1 antibody, growth factor independent 1 transcriptional repressor antibody, Gfi1 antibody, GFI1 antibody
- Background
- Zinc finger protein Gfi-1 is a protein that in humans is encoded by the GFI1 gene. This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene.
- UniProt
- Q99684
-