NFIB antibody
-
- Target See all NFIB Antibodies
- NFIB (Nuclear Factor I/B (NFIB))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NFIB antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR were used as the immunogen for the NFIB antibody.
- Isotype
- IgG
- Top Product
- Discover our top product NFIB Primary Antibody
-
anti-Nuclear Factor I/B (NFIB) (AA 1-420) antibody
NFIB Reactivity: Human WB, ELISA, IHC (p), IF Host: Mouse Monoclonal 2D6 unconjugated
anti-Nuclear Factor I/B (NFIB) antibodyNFIB Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Nuclear Factor I/B (NFIB) antibodyNFIB Reactivity: Human, Mouse, Rat WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Nuclear Factor I/B (NFIB) (AA 255-283) antibodyNFIB Reactivity: Human WB Host: Rabbit Polyclonal RB36790 unconjugated
anti-Nuclear Factor I/B (NFIB) (AA 1-420) antibodyNFIB Reactivity: Human WB Host: Mouse Polyclonal unconjugated
anti-Nuclear Factor I/B (NFIB) (C-Term) antibodyNFIB Reactivity: Human WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Nuclear Factor I/B (NFIB) (AA 1-233) antibodyNFIB Reactivity: Human WB, IP, IHC, ICC Host: Rabbit Polyclonal unconjugated
anti-Nuclear Factor I/B (NFIB) (AA 187-236) antibodyNFIB Reactivity: Human, Mouse, Rat, Rabbit, Cow, Sheep, Guinea Pig, Horse, Monkey, Pig, Xenopus laevis, Bat, Chicken, Hamster WB Host: Rabbit Polyclonal unconjugated
anti-Nuclear Factor I/B (NFIB) antibodyNFIB Reactivity: Human WB Host: Rabbit Monoclonal unconjugated
anti-Nuclear Factor I/B (NFIB) (Middle Region) antibodyNFIB Reactivity: Human, Mouse, Rat, Rabbit, Cow, Sheep, Dog, Guinea Pig, Horse, Zebrafish (Danio rerio) WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
- Optimal dilution of the NFIB antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL, IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the NFIB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- NFIB (Nuclear Factor I/B (NFIB))
- Alternative Name
- NFIB / Nuclear factor 1 B-type (NFIB Products)
- Background
- Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. [UniProt]
- UniProt
- O00712
-
