FZD3 antibody
-
- Target See all FZD3 Antibodies
- FZD3 (Frizzled Family Receptor 3 (FZD3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FZD3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Sequence
- MPNLLNHYDQ QTAALAMEPF HPMVNLDCSR DFRPFL
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for FZD3 detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human FZD3 (MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL).
- Top Product
- Discover our top product FZD3 Primary Antibody
-
-
- Application Notes
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- FZD3 (Frizzled Family Receptor 3 (FZD3))
- Alternative Name
- FZD3 (FZD3 Products)
- Synonyms
- Fz-3 antibody, FZ-3 antibody, fz3 antibody, Xfz3 antibody, frz3 antibody, hfz3 antibody, frz-3 antibody, frizzled3 antibody, frizzled-3 antibody, FZD3 antibody, AU020229 antibody, D930050A07Rik antibody, Fz3 antibody, fz9 antibody, fzd3 antibody, zg09 antibody, fzd3l antibody, frizzled class receptor 3 antibody, frizzled class receptor 3 L homeolog antibody, frizzled class receptor 3a antibody, frizzled class receptor 3b antibody, FZD3 antibody, fzd3 antibody, fzd3.L antibody, Fzd3 antibody, fzd3a antibody, fzd3b antibody
- Background
-
Synonyms: Frizzled-3, Fz-3, hFz3, FZD3
Tissue Specificity: Widely expressed. Relatively high expression in the CNS, including regions of the limbic system, in kidney, pancreas, skeletal muscle, uterus and testis.
Background: Frizzled-3 is a protein that in humans is encoded by the FZD3 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia.
- Pathways
- WNT Signaling, Tube Formation
-