L1CAM antibody
-
- Target See all L1CAM Antibodies
- L1CAM (L1 Cell Adhesion Molecule (L1CAM))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This L1CAM antibody is un-conjugated
-
Application
- Immunohistochemistry (IHC)
- Sequence
- NMVITWKPLR WMDWNAPQVQ YRVQWRPQGT RGPW
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for L1CAM detection. Tested with IHC-P in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human L1CAM (NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW).
- Top Product
- Discover our top product L1CAM Primary Antibody
-
-
- Application Notes
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- L1CAM (L1 Cell Adhesion Molecule (L1CAM))
- Alternative Name
- L1CAM (L1CAM Products)
- Synonyms
- l1cam-a antibody, CAML1 antibody, CD171 antibody, HSAS antibody, HSAS1 antibody, MASA antibody, MIC5 antibody, N-CAM-L1 antibody, N-CAML1 antibody, NCAM-L1 antibody, S10 antibody, SPG1 antibody, L1 antibody, Hsas antibody, Hyd antibody, NCAML1 antibody, L1 cell adhesion molecule S homeolog antibody, L1 cell adhesion molecule antibody, l1cam.S antibody, L1CAM antibody, L1cam antibody
- Background
-
Synonyms: Neural cell adhesion molecule L1, N-CAM-L1, NCAM-L1, CD171, L1CAM, CAML1, MIC5
Background: L1, also known as L1CAM, is a transmembrane protein member of the L1 protein family, encoded by the L1CAM gene. The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause X-linked neurological syndromes known as CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of this gene results in multiple transcript variants, some of which include an alternate exon that is considered to be specific to neurons.
- UniProt
- P32004
- Pathways
- Synaptic Membrane
-