14-3-3 zeta antibody
-
- Target See all 14-3-3 zeta (YWHAZ) Antibodies
- 14-3-3 zeta (YWHAZ)
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This 14-3-3 zeta antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Brand
- Picoband™
- Sequence
- LLEKFLIPNA SQAESKVFYL KMKGDYYRYL AEVAAGDDKK GIVDQ
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for 14-3-3 zeta/delta detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).
- Top Product
- Discover our top product YWHAZ Primary Antibody
-
-
- Application Notes
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- 14-3-3 zeta (YWHAZ)
- Alternative Name
- YWHAZ (YWHAZ Products)
- Synonyms
- 14-3-3-zeta antibody, KCIP-1 antibody, YWHAD antibody, 14-3-3zeta antibody, Ywhaz antibody, ACYPI003154 antibody, 14-3-3z antibody, kcip-1 antibody, ywhaq antibody, 1433z antibody, ywhaz antibody, ywhazb antibody, 1110013I11Rik antibody, AI596267 antibody, AL022924 antibody, AU020854 antibody, ywhaza antibody, fb14h09 antibody, wu:fb05g08 antibody, wu:fb14h09 antibody, ywhai antibody, zgc:55807 antibody, 14-3-3 antibody, 14-3-3 zeta antibody, 14-3-3ZETA antibody, 14-3-3leo antibody, 2G1 antibody, 4-3-3 zeta antibody, 5.11 antibody, 549 antibody, BEST:GH05075 antibody, CG17870 antibody, D14-3-3 antibody, D14-3-3zeta antibody, Dmel\\CG17870 antibody, K antibody, LEO antibody, Leo antibody, PAR-5 antibody, PAR5 antibody, Par-5 antibody, d14-3-3zeta antibody, l(2)07103 antibody, l(2)46CFe antibody, l(2)46Ee antibody, leo antibody, par-5 antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta antibody, 14-3-3 protein zeta antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog antibody, 14-3-3 protein zeta/delta pseudogene antibody, CG17870 gene product from transcript CG17870-RE antibody, YWHAZ antibody, 14-3-3zeta antibody, ywhaz antibody, 1433z antibody, ywhaz.L antibody, Ywhaz antibody, ywhaz.S antibody, LOC100855903 antibody
- Background
-
Synonyms: 14-3-3 protein zeta/delta, Protein kinase C inhibitor protein 1, KCIP-1, YWHAZ
Background: 14-3-3 protein zeta/delta (14-3-3ζ) is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99 % identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.
- UniProt
- P63104
- Pathways
- Apoptosis, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location
-