CEP68 antibody

Catalog No. ABIN5693149

Product Details anti-CEP68 Antibody

Target: CEP68 (Centrosomal Protein 68kDa (CEP68))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CEP68 antibody is un-conjugated

Application: Western Blotting (WB)

Brand: Picoband™

Sequence: ELICWLYNVA DVTDHGTAAR SNLTSLKSSL QLYRQFKKDI D

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for CEP68 detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human CEP68 (ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for CEP68

Target: CEP68 (Centrosomal Protein 68kDa (CEP68))

Alternative Name: CEP68 (CEP68 Products)

Synonyms: RGD1309101 antibody, 6030463E10Rik antibody, AI481761 antibody, BC027174 antibody, Kiaa0582 antibody, KIAA0582 antibody, centrosomal protein 68 antibody, Cep68 antibody, CEP68 antibody

Background:

Synonyms: Centrosomal protein of 68 kDa, Cep68, CEP68, KIAA0582

Background: Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and rootletin depend both on each other for centriole association, and both also require CEP250 for their function.

UniProt: Q76N32

Pathways: SARS-CoV-2 Protein Interactome