Alpha-amylase 1 antibody (AA 20-50)

Catalog No. ABIN5647969

Product Details anti-Alpha-amylase 1 Antibody

Target: Alpha-amylase 1 (AMY1) (Amylase 1, Salivary (AMY1))

Binding Specificity: AA 20-50

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Alpha-amylase 1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 20-50 (NTQQGRTSIVHLFEWRWVDIALECERYLAPK) from the human protein were used as the immunogen for the Alpha Amylase antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Alpha Amylase antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Alpha Amylase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Alpha-amylase 1

Target: Alpha-amylase 1 (AMY1) (Amylase 1, Salivary (AMY1))

Alternative Name: Alpha Amylase 1 (AMY1 Products)

Synonyms: AMY1 antibody, AMY2 antibody, AMY2B antibody, PA antibody, Amy-1 antibody, Amy1a antibody, C030014B17Rik antibody, Amy1 antibody, amylase, alpha 1C (salivary) antibody, amylase, alpha 2A (pancreatic) antibody, amylase 1, salivary antibody, amylase, alpha 1A antibody, amylase, alpha 1A (salivary) antibody, AMY1C antibody, AMY2A antibody, Amy1 antibody, Amy1a antibody, AMY1A antibody

Background: Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.

UniProt: P04745