Peptide YY antibody (AA 29-64)

Catalog No. ABIN5647902

Product Details anti-Peptide YY Antibody

Target: Peptide YY (PYY)

Binding Specificity: AA 29-64

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peptide YY antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 29-64 (YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY) from the mouse protein were used as the immunogen for the PYY antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: Prior to reconstitution, store at 4°C. After reconstitution, the PYY antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Peptide YY

Target: Peptide YY (PYY)

Alternative Name: PYY / Peptide YY (PYY Products)

Synonyms: PYY-I antibody, PYY1 antibody, GHYY antibody, RATGHYY antibody, Yy antibody, peptide-YY antibody, peptide YY antibody, peptide YY (mapped) antibody, PYY antibody, Pyy antibody

Background: Peptide YY (PYY), also known as peptide tyrosine tyrosine, is a peptide that in humans is encoded by the PYY gene. This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa.

UniProt: Q9EPS2