PDE5A antibody (AA 20-63)
-
- Target See all PDE5A Antibodies
- PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))
-
Binding Specificity
- AA 20-63
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDE5A antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids 20-63 (QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH) from the human protein were used as the immunogen for the PDE5A antibody.
- Isotype
- IgG
- Top Product
- Discover our top product PDE5A Primary Antibody
-
-
- Application Notes
- Optimal dilution of the PDE5A antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the PDE5A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))
- Alternative Name
- PDE5 (PDE5A Products)
- Background
- CGMP-specific phosphodiesterase type 5 is an enzyme from the phosphodiesterase class. It is found in various tissues, most prominently the corpus cavernosum and the retina. It has also been recently discovered to play a vital role in the cardiovascular system. Furthermore, PDE5A also plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This PDE5A gene is mapped to 4q26.
- UniProt
- O76074
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling
-