MMP11 antibody (AA 104-135)

Catalog No. ABIN5647881

Product Details anti-MMP11 Antibody

Target: MMP11 (Matrix Metallopeptidase 11 (Stromelysin 3) (MMP11))

Binding Specificity: AA 104-135

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP11 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 104-135 (RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK) from the human protein were used as the immunogen for the MMP11 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the MMP11 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the MMP11 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for MMP11

Target: MMP11 (Matrix Metallopeptidase 11 (Stromelysin 3) (MMP11))

Alternative Name: MMP11 (MMP11 Products)

Synonyms: SL-3 antibody, ST3 antibody, STMY3 antibody, Stmy3 antibody, MMP-11 antibody, matrix metallopeptidase 11 antibody, matrix metallopeptidase 11 L homeolog antibody, stromelysin-3 antibody, MMP11 antibody, Mmp11 antibody, mmp11.L antibody, LOC103694874 antibody

Background: Stromelysin-3 (SL-3) also known as matrix metalloproteinase-11 (MMP-11) is an enzyme that in humans is encoded by the MMP11 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the enzyme encoded by this gene is activated intracellularly by furin within the constitutive secretory pathway. Also in contrast to other MMP's, this enzyme cleaves alpha 1-proteinase inhibitor but weakly degrades structural proteins of the extracellular matrix.

UniProt: P24347