MSI1 antibody (AA 21-54)

Catalog No. ABIN5647867

Product Details anti-MSI1 Antibody

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Binding Specificity: AA 21-54

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MSI1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 21-54 (KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD) from the human protein were used as the immunogen for the Musashi antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Musashi antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Musashi antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for MSI1

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Alternative Name: MSI1 / Musashi 1 (MSI1 Products)

Synonyms: CG5099 antibody, DMSIDNA antibody, Dmel\\CG5099 antibody, Msi antibody, SIDNA antibody, anon-EST:Liang-2.35 antibody, clone 2.35 antibody, Msi1h antibody, Musashi antibody, Musashi-1 antibody, Musashi1 antibody, XNrp-1 antibody, nrp-1B antibody, Dsim\\GD21224 antibody, GD21224 antibody, dsim_GLEANR_4982 antibody, msi antibody, musashi antibody, Musahi1 antibody, m-Msi-1 antibody, msi1h antibody, musashi antibody, musashi RNA binding protein 1 antibody, GD21224 gene product from transcript GD21224-RD antibody, musashi RNA-binding protein 1 antibody, musashi RNA binding protein 1 S homeolog antibody, msi antibody, msi1 antibody, Dsim\msi antibody, MSI1 antibody, Msi1 antibody, msi1.S antibody

Background: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

UniProt: O43347

Pathways: Stem Cell Maintenance