SUB1 antibody (AA 96-127)

Catalog No. ABIN5647848

Product Details anti-SUB1 Antibody

Target: SUB1 (Activated RNA Polymerase II Transcriptional Coactivator p15 (SUB1))

Binding Specificity: AA 96-127

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SUB1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 96-127 (MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL) from the human protein were used as the immunogen for the PC4 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the PC4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for SUB1

Target: SUB1 (Activated RNA Polymerase II Transcriptional Coactivator p15 (SUB1))

Alternative Name: PC4 / Positive cofactor 4 (SUB1 Products)

Synonyms: P15 antibody, PC4 antibody, p14 antibody, AI842364 antibody, P9 antibody, Pc4 antibody, Rpo2tc1 antibody, SUB1 homolog, transcriptional regulator antibody, SUB1 homolog (S. cerevisiae) antibody, SUB1 antibody, Sub1 antibody

Background: Activated RNA polymerase II transcriptional coactivator p15, also known as Positive cofactor 4 (PC4) or SUB1 homolog, is a protein that in humans is encoded by the SUB1 gene. This gene is mapped to 5p13.3. The transcriptional cofactor PC4 is an ancient single-strand DNA (ssDNA)-binding protein that has a homologue in bacteriophage T5 where it is likely the elusive replicative ssDNA-binding protein. The recombinant PC4 is shown to function identically to the native protein through its interaction with TAFs.

UniProt: P53999