12-Lipoxygenase antibody (AA 186-231)
LOX12
Reactivity: Human, Mouse, Rat
WB
Host: Rabbit
Polyclonal
unconjugated
1 image
-
- Target See all 12-Lipoxygenase (LOX12) products
- 12-Lipoxygenase (LOX12)
- Binding Specificity
- AA 186-231
- Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This 12-Lipoxygenase antibody is un-conjugated
- Application
- Western Blotting (WB)
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids 186-231 (ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ) from the human protein were used as the immunogen for the 12 Lipoxygenase antibody.
- Isotype
- IgG
-
anti-12-Lipoxygenase (LOX12) (C-Term) antibody
LOX12 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
- Optimal dilution of the 12 Lipoxygenase antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the 12 Lipoxygenase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- 12-Lipoxygenase (LOX12)
- Alternative Name
- 12 Lipoxygenase (LOX12 Products)
- Synonyms
- 12-LOX antibody, 12S-LOX antibody, LOG12 antibody, wu:fi89d03 antibody, zgc:153926 antibody, arachidonate 12-lipoxygenase, 12S type antibody, zgc:152891 antibody, ALOX12 antibody, zgc:152891 antibody
- Background
- ALOX12 (Arachidonate 12-lipoxygenase) is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12(S)-hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.
- UniProt
- P18054
-
You are here:
