MC2R antibody (AA 268-297)

Catalog No. ABIN5647725

Product Details anti-MC2R Antibody

Target: MC2R (Melanocortin 2 Receptor (Adrenocorticotropic Hormone) (MC2R))

Binding Specificity: AA 268-297

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MC2R antibody is un-conjugated

Application: Western Blotting (WB)

Cross-Reactivity (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogen: Amino acids 268-297 (NAVIDPFIYAFRSPELRDAFKKMIFCSRYW) from the human protein were used as the immunogen for the MC2R antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the MC2R antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the MC2R antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for MC2R

Target: MC2R (Melanocortin 2 Receptor (Adrenocorticotropic Hormone) (MC2R))

Alternative Name: MC2 Receptor / ACTH Receptor (MC2R Products)

Synonyms: ACTHR antibody, ACTH-R antibody, MC2-R antibody, MC2R antibody, MC2 antibody, melanocortin 2 receptor antibody, MC2R antibody, Mc2r antibody, mc2r antibody

Background: Melanocortin-2 receptor (MC2R), also known as ACTH receptor (ACTHR), is a member of the G protein-coupled receptor family. This gene is mapped to 18p11.2. MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency. Alternate transcript variants have been found for this gene.

UniProt: Q01718

Pathways: cAMP Metabolic Process