LYN antibody (AA 470-501)

Catalog No. ABIN5647656

Product Details anti-LYN Antibody

Target: LYN (V-Yes-1 Yamaguchi Sarcoma Viral Related Oncogene Homolog (LYN))

Binding Specificity: AA 470-501

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYN antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 470-501 (DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY) were used as the immunogen for the LYN antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the LYN antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the LYN antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for LYN

Target: LYN (V-Yes-1 Yamaguchi Sarcoma Viral Related Oncogene Homolog (LYN))

Alternative Name: LYN (LYN Products)

Synonyms: JTK8 antibody, p53Lyn antibody, p56Lyn antibody, lyn antibody, LYN antibody, AA407514 antibody, Hck-2 antibody, jtk8 antibody, lyn-A antibody, CH73-38P6.3 antibody, zgc:92124 antibody, LYN proto-oncogene, Src family tyrosine kinase antibody, v-yes-1 Yamaguchi sarcoma viral related oncogene homolog antibody, tyrosine-protein kinase Lyn antibody, LYN proto-oncogene, Src family tyrosine kinase L homeolog antibody, LYN antibody, lyn antibody, Lyn antibody, LOC100593961 antibody, lyn.L antibody

Background: Tyrosine-protein kinase Lyn is a protein that in humans is encoded in humans by the LYN gene. It is mapped to 8q12.1. Lyn is a member of the Src family of protein tyrosine kinases. In various hematopoietic cells, Lyn has emerged as a key enzyme involved in the regulation of cell activation.Lyn has been described to have an inhibitory role in myeloid lineage proliferation.

UniProt: P07948

Pathways: Fc-epsilon Receptor Signaling Pathway, Hormone Transport, Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling, Integrin Complex, BCR Signaling