HMGB1 antibody (AA 124-154)

Catalog No. ABIN5647575

Product Details anti-HMGB1 Antibody

Target: HMGB1 (High Mobility Group Box 1 (HMGB1))

Binding Specificity: AA 124-154

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HMGB1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 124-154 (DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK) from the human protein were used as the immunogen for the HMGB1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the HMGB1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the HMGB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for HMGB1

Target: HMGB1 (High Mobility Group Box 1 (HMGB1))

Alternative Name: HMGB1 (HMGB1 Products)

Synonyms: HMG1 antibody, HMG3 antibody, SBP-1 antibody, DEF antibody, HMG-1 antibody, Hmg1 antibody, amphoterin antibody, p30 antibody, hmgb1 antibody, ik:tdsubc_1a5 antibody, wu:fb23c02 antibody, xx:tdsubc_1a5 antibody, zgc:56110 antibody, zgc:77104 antibody, hmg-1 antibody, hmg3 antibody, sbp-1 antibody, hmg1 antibody, HMGB1 antibody, Ac2-008 antibody, high mobility group box 1 antibody, high-mobility group box 1 antibody, high mobility group box 1a antibody, high mobility group box 1 L homeolog antibody, high mobility group protein B1 antibody, HMGB1 antibody, Hmgb1 antibody, hmgb1 antibody, hmgb1a antibody, hmgb1.L antibody, LOC100359149 antibody

Background: High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.

UniProt: P09429

Pathways: p53 Signaling, Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process, Toll-Like Receptors Cascades, Smooth Muscle Cell Migration, Inflammasome